Recombinant Human plexin A2 Protein, GST-tagged

• Cat.No.: PLXNA2-23H
• Product Overview: Recombinant Human cDNA FLJ11751 fis, clone HEMBA1005576, moderately similar to Mus musculus plexin 2 (H11Y , S17F) with N-GST tag was expressed in yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: GST
• Protein Length: 1743-1894aa
• Description: This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
• Tag: N-GST
• Form: Lyophilized powder
• Molecular Mass: 43 kDa
• AA Sequence: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
• Purity: ≥85 %, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Short term: 2 to 8 centigrade, one week after reconstitution
  Long term: -20 to -80 centigrade, twelve months from the date of receipt
• Storage Buffer: Lyophilized from PBS, 6 % Trehalose, pH 7.4. The volume before lyophilization is 500μl/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50 % of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50 %. Customers could use it as reference.

Gene Information

• Gene Name: PLXNA2 plexin A2 [Homo sapiens (human)]
• Official Symbol: PLXNA2
• Synonyms: PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT
• Gene ID: 5362
• mRNA Refseq: NM_025179
• Protein Refseq: NP_079455
• MIM: 601054
• UniProt ID: Q9HAE7