Recombinant Human PLEC Protein, GST-tagged

• Cat.No.: PLEC1-32H
• Product Overview: Human PLEC1 partial ORF ( NP_000436, 4384 a.a. - 4493 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PLEC plectin [ Homo sapiens (human) ]
• Official Symbol: PLEC
• Synonyms: HD1; PCN; EBS1; EBSO; PLEC1b; PLTN; Hemidesmosomal protein 1; Intermediate Filament Binding Protein 500kDa; Epidermolysis Bullosa Simplex 1(Ogna)
• Gene ID: 5339
• mRNA Refseq: NM_000445.4
• Protein Refseq: NP_000436.2
• MIM: 601282
• UniProt ID: Q15149