Recombinant Human PLEC, His-tagged

Cat.No. : PLEC-30873TH
Product Overview : Recombinant fragment, corresponding to amino acids 4045-4505 of Human Plectin isoform 7 with N terminal His tag. Predicted mwt: 51 kDa, observed mwt: 53kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Plectin is a prominent member of an important family of structurally and in part functionally related proteins, termed plakins or cytolinkers, that are capable of interlinking different elements of the cytoskeleton. Plakins, with their multi-domain structure and enormous size, not only play crucial roles in maintaining cell and tissue integrity and orchestrating dynamic changes in cytoarchitecture and cell shape, but also serve as scaffolding platforms for the assembly, positioning, and regulation of signaling complexes (reviewed in PMID: 9701547, 11854008, and 17499243). Plectin is expressed as several protein isoforms in a wide range of cell types and tissues from a single gene located on chromosome 8 in humans (PMID: 8633055, 8698233). Until 2010, this locus was named plectin 1 (symbol PLEC1 in human; Plec1 in mouse and rat) and the gene product had been referred to as "hemidesmosomal protein 1" or "plectin 1, intermediate filament binding 500kDa". These names were superseded by plectin. The plectin gene locus in mouse on chromosome 15 has been analyzed in detail (PMID: 10556294, 14559777), revealing a genomic exon-intron organization with well over 40 exons spanning over 62 kb and an unusual 5 transcript complexity of plectin isoforms. Eleven exons (1-1j) have been identified that alternatively splice directly into a common exon 2 which is the first exon to encode plectins highly conserved actin binding domain (ABD). Three additional exons (-1, 0a, and 0) splice into an alternative first coding exon (1c), and two additional exons (2alpha and 3alpha) are optionally spliced within the exons encoding the acting binding domain (exons 2-8). Analysis of the human locus has identified eight of the eleven alternative 5 exons found in mouse and rat (PMID: 14672974); exons 1i, 1j and 1h have not been confirmed in human. Furthermore, isoforms lacking the central rod domain encoded by exon 31 have been detected in mouse (PMID:10556294), rat (PMID: 9177781), and human (PMID: 11441066, 10780662, 20052759). The short alternative amino-terminal sequences encoded by the different first exons direct the targeting of the various isoforms to distinct subcellular locations (PMID: 14559777). As the expression of specific plectin isoforms was found to be dependent on cell type (tissue) and stage of development (PMID: 10556294, 12542521, 17389230) it appears that each cell type (tissue) contains a unique set (proportion and composition) of plectin isoforms, as if custom-made for specific requirements of the particular cells. Concordantly, individual isoforms were found to carry out distinct and specific functions (PMID: 14559777, 12542521, 18541706). In 1996, a number of groups reported that patients suffering from epidermolysis bullosa simplex with muscular dystrophy (EBS-MD) lacked plectin expression in skin and muscle tissues due to defects in the plectin gene (PMID: 8698233, 8941634, 8636409, 8894687, 8696340). Two other subtypes of plectin-related EBS have been described: EBS-pyloric atresia (PA) and EBS-Ogna. For reviews of plectin-related diseases see PMID: 15810881, 19945614. Mutations in the plectin gene related to human diseases should be named based on the position in NM_000445 (variant 1, isoform 1c), unless the mutation is located within one of the other alternative first exons, in which case the position in the respective Reference Sequence should be used.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : (Amino acid sequence (Sequence determined by 5 Sequencing))NEILTDPSDDTKGFFDPNTEENLTYL QLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRR VVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEE ITISSSDGVVKSMIIDRRSGRQYDIDDAIAKNLIDRSA LDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSY PISPAVSRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTD AVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQ ALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDE ALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDAL DRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGSGSTAG SRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSG YGRRYASGSSA
Protein length : 4045-4505 a.a.
Gene Name PLEC plectin [ Homo sapiens ]
Official Symbol PLEC
Synonyms PLEC; plectin; EBS1, epidermolysis bullosa simplex 1 (Ogna) , PLEC1, plectin 1, intermediate filament binding protein 500kDa , plectin 1, intermediate filament binding protein, 500kD; PCN; PLTN;
Gene ID 5339
mRNA Refseq NM_000445
Protein Refseq NP_000436
MIM 601282
Uniprot ID Q15149
Chromosome Location 8q24
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem;
Function actin binding; protein binding; structural constituent of muscle; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLEC Products

Required fields are marked with *

My Review for All PLEC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon