Recombinant Human PLD2 protein, GST-tagged
Cat.No. : | PLD2-301262H |
Product Overview : | Recombinant Human PLD2 (1-141 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asn141 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PLD2 phospholipase D2 [ Homo sapiens ] |
Official Symbol | PLD2 |
Synonyms | PLD2; phospholipase D2; choline phosphatase 2; PLD1C; hPLD2; phosphatidylcholine-hydrolyzing phospholipase D2; |
Gene ID | 5338 |
mRNA Refseq | NM_001243108 |
Protein Refseq | NP_001230037 |
MIM | 602384 |
UniProt ID | O14939 |
◆ Recombinant Proteins | ||
PLD2-383HF | Recombinant Full Length Human PLD2 Protein, GST-tagged | +Inquiry |
PLD2-3039H | Recombinant Human PLD2 protein, His-tagged | +Inquiry |
PLD2-679H | Recombinant Human PLD2, GST-tagged | +Inquiry |
PLD2-301262H | Recombinant Human PLD2 protein, GST-tagged | +Inquiry |
PLD2-6823M | Recombinant Mouse PLD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLD2 Products
Required fields are marked with *
My Review for All PLD2 Products
Required fields are marked with *
0
Inquiry Basket