Recombinant Human PLCZ1 protein, His/sumo-tagged
Cat.No. : | PLCZ1-137H |
Product Overview : | Recombinant Human PLCZ1(1-415aa) fused with His/sumotag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-415aa |
Description : | The protein encoded by this gene is a member of the phosphoinositide-specific phospholipase C family. Members in this family, classified into six isotypes that are tissue- and organ-specific, hydrolyze phosphatidylinositol 4,5-bisphosphate just before the phosphate group to yield diacylglycerol and inositol 1,4,5-trisphosphate. This protein localizes to the acrosome in spermatozoa and elicits Ca(2+) oscillations and egg activation during fertilization that leads to early embryonic development. Alternative splicing results in multiple transcript variants. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKTSDYPVVLSLENHCSTAQQEVMADNLQATF GESLLSDMLDDFPDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKL KIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNF NPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLISGIQ LPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFL GQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR |
Purity : | >90% ( SDS-PAGE ) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | PLCZ1 phospholipase C, zeta 1 [ Homo sapiens ] |
Official Symbol | PLCZ1 |
Synonyms | PLCZ1; phospholipase C, zeta 1; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1; NYD SP27; PLCzeta; PLC-zeta-1; phospholipase C-zeta-1; PI-phospholipase C zeta 1; testis-development protein NYD-SP27; testis-development related NYD-SP27; phosphoinositide phospholipase C-zeta-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1; NYD-SP27; MGC149685; |
Gene ID | 89869 |
mRNA Refseq | NM_033123 |
Protein Refseq | NP_149114 |
MIM | 608075 |
UniProt ID | Q86YW0 |
Chromosome Location | 12p13.31 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, organism-specific biosystem; D-myo-inositol-5-phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=> |
Function | calcium ion binding; hydrolase activity; phosphatidylinositol phospholipase C activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GLP1R-2565R | Recombinant Rat Glp1r protein, His/SUMO-tagged | +Inquiry |
RFL14692MF | Recombinant Full Length Mycoplasma Capricolum Subsp. Capricolum Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
IGIP-4284H | Recombinant Human IGIP protein, His-KSI-tagged | +Inquiry |
CWH43-4093M | Recombinant Mouse CWH43 Protein | +Inquiry |
TMEM176-7354Z | Recombinant Zebrafish TMEM176 | +Inquiry |
◆ Native Proteins | ||
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVCA2-3510HCL | Recombinant Human OVCA2 293 Cell Lysate | +Inquiry |
SLFNL1-1684HCL | Recombinant Human SLFNL1 293 Cell Lysate | +Inquiry |
DAZ4-7070HCL | Recombinant Human DAZ4 293 Cell Lysate | +Inquiry |
Postcentral Gyrus-48H | Human Postcentral Gyrus Tissue Lysate | +Inquiry |
KLK11-2680HCL | Recombinant Human KLK11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLCZ1 Products
Required fields are marked with *
My Review for All PLCZ1 Products
Required fields are marked with *
0
Inquiry Basket