Recombinant Human PLCZ1 protein, His/sumo-tagged

Cat.No. : PLCZ1-137H
Product Overview : Recombinant Human PLCZ1(1-415aa) fused with His/sumotag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
ProteinLength : 1-415aa
Description : The protein encoded by this gene is a member of the phosphoinositide-specific phospholipase C family. Members in this family, classified into six isotypes that are tissue- and organ-specific, hydrolyze phosphatidylinositol 4,5-bisphosphate just before the phosphate group to yield diacylglycerol and inositol 1,4,5-trisphosphate. This protein localizes to the acrosome in spermatozoa and elicits Ca(2+) oscillations and egg activation during fertilization that leads to early embryonic development. Alternative splicing results in multiple transcript variants.
Form : Tris-based buffer,50% glycerol
AA Sequence : MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKTSDYPVVLSLENHCSTAQQEVMADNLQATF GESLLSDMLDDFPDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKL KIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNF NPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLISGIQ LPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFL GQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR
Purity : >90% ( SDS-PAGE )
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name PLCZ1 phospholipase C, zeta 1 [ Homo sapiens ]
Official Symbol PLCZ1
Synonyms PLCZ1; phospholipase C, zeta 1; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1; NYD SP27; PLCzeta; PLC-zeta-1; phospholipase C-zeta-1; PI-phospholipase C zeta 1; testis-development protein NYD-SP27; testis-development related NYD-SP27; phosphoinositide phospholipase C-zeta-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1; NYD-SP27; MGC149685;
Gene ID 89869
mRNA Refseq NM_033123
Protein Refseq NP_149114
MIM 608075
UniProt ID Q86YW0
Chromosome Location 12p13.31
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, organism-specific biosystem; D-myo-inositol-5-phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=>
Function calcium ion binding; hydrolase activity; phosphatidylinositol phospholipase C activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLCZ1 Products

Required fields are marked with *

My Review for All PLCZ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon