Recombinant Human PLAGL1 protein, His-tagged

• Cat.No.: PLAGL1-3585H
• Product Overview: Recombinant Human PLAGL1 protein(201-463 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 201-463 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PLAGL1 pleiomorphic adenoma gene-like 1 [ Homo sapiens ]
• Official Symbol: PLAGL1
• Synonyms: PLAGL1; pleiomorphic adenoma gene-like 1; zinc finger protein PLAGL1; LOT1; ZAC; LOT-1; PLAG-like 1; ZAC tumor supressor; tumor supressor ZAC; lost on transformation 1; pleiomorphic adenoma-like protein 1; pleiomorphic adenoma gene-like protein 1; ZAC1; MGC126275; MGC126276; DKFZp781P1017
• Gene ID: 5325
• mRNA Refseq: NM_001080951
• Protein Refseq: NP_001074420
• MIM: 603044
• UniProt ID: Q9UM63