Recombinant Human PLAGL1 protein, His-tagged

Cat.No. : PLAGL1-3585H
Product Overview : Recombinant Human PLAGL1 protein(201-463 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 201-463 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : RHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol PLAGL1
Synonyms PLAGL1; pleiomorphic adenoma gene-like 1; zinc finger protein PLAGL1; LOT1; ZAC; LOT-1; PLAG-like 1; ZAC tumor supressor; tumor supressor ZAC; lost on transformation 1; pleiomorphic adenoma-like protein 1; pleiomorphic adenoma gene-like protein 1; ZAC1; MGC126275; MGC126276; DKFZp781P1017;
Gene ID 5325
mRNA Refseq NM_001080951
Protein Refseq NP_001074420
MIM 603044
UniProt ID Q9UM63

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLAGL1 Products

Required fields are marked with *

My Review for All PLAGL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon