Recombinant Human PLA2G10 protein, His-GST&Myc-tagged

• Cat.No.: PLA2G10-307H
• Product Overview: Recombinant Human PLA2G10 protein(O15496)(43-165aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST&C-Myc
• Protein length: 43-165aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.8 kDa
• AASequence: GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PLA2G10 phospholipase A2, group X [ Homo sapiens ]
• Official Symbol: PLA2G10
• Synonyms: PLA2G10; phospholipase A2, group X; group 10 secretory phospholipase A2; GXPLA2; sPLA2-X; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; SPLA2; GXSPLA2; MGC119918; MGC119919; MGC133367
• Gene ID: 8399
• mRNA Refseq: NM_003561
• Protein Refseq: NP_003552
• MIM: 603603
• UniProt ID: O15496