Recombinant Human PIP5K1C protein, GST-tagged

• Cat.No.: PIP5K1C-5733H
• Product Overview: Recombinant Human PIP5K1C protein(480-573 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 480-573 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PIP5K1C
• Synonyms: PIP5K1C; phosphatidylinositol-4-phosphate 5-kinase, type I, gamma; phosphatidylinositol-4-phosphate 5-kinase type-1 gamma; KIAA0589; LCCS3; PIP5Kgamma; PIP5K1-gamma; type I PIP kinase; diphosphoinositide kinase; ptdIns(4)P-5-kinase 1 gamma; Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma; PIPKIg_v4; PIP5K-GAMMA
• Gene ID: 23396
• mRNA Refseq: NM_001195733
• Protein Refseq: NP_001182662
• MIM: 606102
• UniProt ID: O60331