Recombinant Human PILRB protein, GST-tagged

Cat.No. : PILRB-1722H
Product Overview : Recombinant Human PILRB(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
Protein length : 81 a.a. - 180 a.a.
AA Sequence : FYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTT TTTWRPSSTTTIAGLRVTESKGHSE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PILRB paired immunoglobin-like type 2 receptor beta [ Homo sapiens ]
Official Symbol PILRB
Synonyms PILRB; paired immunoglobin-like type 2 receptor beta; paired immunoglobulin-like type 2 receptor beta; FDFACT1; FDFACT2; activating receptor PILRbeta; cell surface receptor FDFACT; activating receptor PILR-beta; cell surface receptor FDFACT1; cell surface receptor FDFACT2; paired immunoglobin-like receptor beta; paired immunoglobulin-like receptor beta;
Gene ID 29990
mRNA Refseq NM_178238
Protein Refseq NP_839956
MIM 605342
UniProt ID Q9UKJ0
Chromosome Location 7q22.1
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem;
Function protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PILRB Products

Required fields are marked with *

My Review for All PILRB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon