Recombinant Human PILRB protein, GST-tagged

• Cat.No.: PILRB-1722H
• Product Overview: Recombinant Human PILRB(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• Protein length: 81 a.a. - 180 a.a.
• AA Sequence: FYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTT TTTWRPSSTTTIAGLRVTESKGHSE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PILRB paired immunoglobin-like type 2 receptor beta [ Homo sapiens ]
• Official Symbol: PILRB
• Synonyms: PILRB; paired immunoglobin-like type 2 receptor beta; paired immunoglobulin-like type 2 receptor beta; FDFACT1; FDFACT2; activating receptor PILRbeta; cell surface receptor FDFACT; activating receptor PILR-beta; cell surface receptor FDFACT1; cell surface receptor FDFACT2; paired immunoglobin-like receptor beta; paired immunoglobulin-like receptor beta
• Gene ID: 29990
• mRNA Refseq: NM_178238
• Protein Refseq: NP_839956
• MIM: 605342
• UniProt ID: Q9UKJ0
• Chromosome Location: 7q22.1
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem
• Function: protein binding; receptor activity