Recombinant Human PIK3CD protein, His-tagged

• Cat.No.: PIK3CD-8555H
• Product Overview: Recombinant Human PIK3CD protein(395-580 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 395-580 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PIK3CD phosphoinositide-3-kinase, catalytic, delta polypeptide [ Homo sapiens ]
• Official Symbol: PIK3CD
• Synonyms: PIK3CD; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; p110D; phosphatidylinositol 3 kinase; catalytic; delta polypeptide; phosphoinositide 3 kinase C; PI3Kdelta; phosphoinositide-3-kinase C; PI3-kinase p110 subunit delta; ptdIns-3-kinase subunit p110-delta; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PI3K; P110DELTA
• mRNA Refseq: NM_005026
• Protein Refseq: NP_005017
• MIM: 602839
• UniProt ID: O00329
• Gene ID: 5293