Recombinant Human PIK3CB protein, His-tagged

Cat.No. : PIK3CB-3991H
Product Overview : Recombinant Human PIK3CB protein(139-373 aa), fused to His tag, was expressed in E. coli.
Availability March 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 139-373 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PIK3CB phosphoinositide-3-kinase, catalytic, beta polypeptide [ Homo sapiens ]
Official Symbol PIK3CB
Synonyms PIK3CB; phosphoinositide-3-kinase, catalytic, beta polypeptide; PIK3C1; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; PI3K-beta; PtdIns-3-kinase p110; PI3-kinase subunit beta; PI3-kinase p110 subunit beta; ptdIns-3-kinase subunit beta; ptdIns-3-kinase subunit p110-beta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; PI3K; P110BETA; PI3KBETA; MGC133043; DKFZp779K1237;
Gene ID 5291
mRNA Refseq NM_001256045
Protein Refseq NP_001242974
MIM 602925
UniProt ID P42338

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PIK3CB Products

Required fields are marked with *

My Review for All PIK3CB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon