Recombinant Human PIK3C2B protein, GST-tagged

• Cat.No.: PIK3C2B-1871H
• Product Overview: Recombinant Human PIK3C2B protein(1-350 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-350 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNATPGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PIK3C2B phosphoinositide-3-kinase, class 2, beta polypeptide [ Homo sapiens ]
• Official Symbol: PIK3C2B
• Synonyms: PIK3C2B; phosphoinositide-3-kinase, class 2, beta polypeptide; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; C2 PI3K; PI3K C2beta; PI3K-C2beta; PI3K-C2-beta; PTDINS-3-kinase C2 beta; ptdIns-3-kinase C2 subunit beta; phosphoinositide 3-kinase-C2-beta; phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide; C2-PI3K; DKFZp686G16234
• Gene ID: 5287
• mRNA Refseq: NM_002646
• Protein Refseq: NP_002637
• MIM: 602838
• UniProt ID: O00750