Recombinant Human PIH1D3 Protein, GST-tagged

• Cat.No.: PIH1D3-2196H
• Product Overview: Human CXorf41 full-length ORF ( NP_775765.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PIH1D3 (PIH1 Domain Containing 3) is a Protein Coding gene. Diseases associated with PIH1D3 include Primary Ciliary Dyskinesia. GO annotations related to this gene include chaperone binding.
• Molecular Mass: 50.5 kDa
• AA Sequence: MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PIH1D3 PIH1 domain containing 3 [ Homo sapiens ]
• Official Symbol: PIH1D3
• Synonyms: CXorf41; NYSAR97; PIH1 domain containing 3; PIH1 domain containing protein 3; protein PIH1D3; sarcoma antigen NY-SAR-97
• Gene ID: 139212
• mRNA Refseq: NM_173494.1
• Protein Refseq: NP_775765.1
• MIM: 300933
• UniProt ID: Q9NQM4