Recombinant Full Length Human PIH1D3 Protein, GST-tagged

Cat.No. : PIH1D3-2350HF
Product Overview : Human CXorf41 full-length ORF ( NP_775765.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 214 amino acids
Description : PIH1D3 (PIH1 Domain Containing 3) is a Protein Coding gene. Diseases associated with PIH1D3 include Primary Ciliary Dyskinesia. GO annotations related to this gene include chaperone binding.
Molecular Mass : 50.5 kDa
AA Sequence : MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PIH1D3 PIH1 domain containing 3 [ Homo sapiens ]
Official Symbol PIH1D3
Synonyms CXorf41; NYSAR97; PIH1 domain containing 3; PIH1 domain containing protein 3; protein PIH1D3; sarcoma antigen NY-SAR-97;
Gene ID 139212
mRNA Refseq NM_173494.1
Protein Refseq NP_775765.1
MIM 300933
UniProt ID Q9NQM4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PIH1D3 Products

Required fields are marked with *

My Review for All PIH1D3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon