Recombinant Human PIGF

• Cat.No.: PIGF-456H
• Product Overview: Recombinant Human Placental growth Factor was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: PIGF-456H
• Description: PlGF (Placental growth Factor) was isolated initially as a cDNA from a human placenta cDNA library. PlGF is expressed also in human umbilical vein endothelial cells colon and mammary carcinomas. Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. The biologically active form of this protein is a disulfide-linked dimer. The N-glycosylated dimeric protein is secreted and stimulates the proliferation of endothelial cell lines and supports angiogenesis.
• Source: human 293 cells.
• Theoretical Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWG RSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPV ETAN VT MQLL KIRSG DRPS YVELTFSQHVRCECRPLREKMKPERCGD AVPRR.
• Molecular Mass: PlGF migrates as two broad bands between 17 and 30 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted molecular mass of 16.7kDa.
• PI: PlGF separates into a number of glycoforms with varying pI values on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted pI of 6.3.
• % Carbohydrate: purified PlGF consists of 0-38% carbohydrate by weight.
• Glycosylation: PlGF has N-linked and O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C.
• Tag: Non

Gene Information

• Gene Name: PIGF phosphatidylinositol glycan anchor biosynthesis, class F [ Homo sapiens ]
• Synonyms: phosphatidylinositol glycan anchor biosynthesis, class F; MGC32646; MGC33136; PIGF; phosphatidylinositol glycan, class F; PIG-F; GPI11 homolog; OTTHUMP00000159031
• Gene ID: 5281
• mRNA Refseq: NM_002643
• Protein Refseq: NP_002634
• MIM: 600153
• UniProt ID: Q07326
• Chromosome Location: 2p21-p16
• Pathway: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Metabolic pathways; Metabolism of proteins
• Function: ethanolaminephosphotransferase activity; protein binding