Recombinant Human PI3 Protein, His-tagged

• Cat.No.: PI3-212H
• Product Overview: Recombinant Human PI3 fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5
• Molecular Mass: 11kD
• AA Sequence: AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: PI3 peptidase inhibitor 3, skin-derived [ Homo sapiens ]
• Official Symbol: PI3
• Synonyms: PI3; peptidase inhibitor 3, skin-derived; protease inhibitor 3, skin derived (SKALP); elafin; cementoin; ELAFIN; ESI; SKALP; skin derived antileukoproteinase; trappin 2; WAP3; WFDC14; PI-3; trappin-2; pre-elafin; protease inhibitor WAP3; elastase-specific inhibitor; skin-derived antileukoproteinase; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; protease inhibitor 3, skin-derived (SKALP); MGC13613
• Gene ID: 5266
• mRNA Refseq: NM_002638
• Protein Refseq: NP_002629
• MIM: 182257
• UniProt ID: P19957