Recombinant Human PHPT1, His-tagged

• Cat.No.: PHPT1-29584TH
• Product Overview: Recombinant full length Human PHPT1 with an N terminal His tag; 145 amino acids with a predicted MWt 15.9kDa including tag,.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 125 amino acids
• Description: PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I (Ek et al.
• Conjugation: HIS
• Molecular Weight: 15.900kDa
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Gene Information

• Gene Name: PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ]
• Official Symbol: PHPT1
• Synonyms: PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14
• Gene ID: 29085
• mRNA Refseq: NM_001135861
• Protein Refseq: NP_001129333
• MIM: 610167
• Uniprot ID: Q9NRX4
• Chromosome Location: 9q34.3
• Pathway: Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem
• Function: calcium channel inhibitor activity; hydrolase activity; ion channel binding; phosphohistidine phosphatase activity; phosphohistidine phosphatase activity