Recombinant Human PHPT1 Protein (1-125 aa), His-tagged
Cat.No. : | PHPT1-1482H |
Product Overview : | Recombinant Human PHPT1 Protein (1-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-125 aa |
Description : | Exhibits phosphohistidine phosphatase activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.8 kDa |
AA Sequence : | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ] |
Official Symbol | PHPT1 |
Synonyms | PHPT1; PHP14; 1700008C22Rik; CGI-202; RP11-216L13.10; |
Gene ID | 29085 |
mRNA Refseq | NM_001135861 |
Protein Refseq | NP_001129333 |
MIM | 610167 |
UniProt ID | Q9NRX4 |
◆ Recombinant Proteins | ||
PHPT1-5066C | Recombinant Chicken PHPT1 | +Inquiry |
PHPT1-800H | Recombinant Human PhosphoHistidine Phosphatase 1, His-tagged | +Inquiry |
PHPT1-753H | Recombinant Human PHPT1 Protein, His-tagged | +Inquiry |
Phpt1-754M | Recombinant Mouse Phpt1 Protein, His-tagged | +Inquiry |
Phpt1-4845M | Recombinant Mouse Phpt1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHPT1-3215HCL | Recombinant Human PHPT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHPT1 Products
Required fields are marked with *
My Review for All PHPT1 Products
Required fields are marked with *
0
Inquiry Basket