Recombinant Human PHPT1 Protein (1-125 aa), His-tagged

Cat.No. : PHPT1-1482H
Product Overview : Recombinant Human PHPT1 Protein (1-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-125 aa
Description : Exhibits phosphohistidine phosphatase activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.8 kDa
AA Sequence : MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ]
Official Symbol PHPT1
Synonyms PHPT1; PHP14; 1700008C22Rik; CGI-202; RP11-216L13.10;
Gene ID 29085
mRNA Refseq NM_001135861
Protein Refseq NP_001129333
MIM 610167
UniProt ID Q9NRX4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PHPT1 Products

Required fields are marked with *

My Review for All PHPT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon