Recombinant Human PHF13 protein, His-tagged

• Cat.No.: PHF13-7854H
• Product Overview: Recombinant Human PHF13 protein(73-217 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 73-217 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: GFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PHF13
• Synonyms: PHF13; PHD finger protein 13; MGC43399; PHD zinc finger protein PHF5; survival time-associated PHD protein in ovarian cancer; survival time-associated PHD finger protein in ovarian cancer 1; PHF5; SPOC1
• Gene ID: 148479
• mRNA Refseq: NM_153812
• Protein Refseq: NP_722519
• UniProt ID: Q86YI8