Recombinant Human PHF13 protein, GST-tagged

• Cat.No.: PHF13-301146H
• Product Overview: Recombinant Human PHF13 (73-217 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Gly73-Asn217
• AA Sequence: GFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PHF13 PHD finger protein 13 [ Homo sapiens ]
• Official Symbol: PHF13
• Synonyms: PHF13; PHD finger protein 13; MGC43399; PHD zinc finger protein PHF5; survival time-associated PHD protein in ovarian cancer; survival time-associated PHD finger protein in ovarian cancer 1; PHF5; SPOC1
• Gene ID: 148479
• mRNA Refseq: NM_153812
• Protein Refseq: NP_722519
• UniProt ID: Q86YI8