Recombinant Human PGF protein, His-tagged
Cat.No. : | PGF-3061H |
Product Overview : | Recombinant Human PGF protein(19-131 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-131 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PGF placental growth factor [ Homo sapiens ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760; |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
UniProt ID | P49763 |
◆ Recombinant Proteins | ||
PGF-607H | Recombinant Human Placental Growth Factor | +Inquiry |
PGF-100H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-28H | Active Recombinant Human PGF, mFc-tagged | +Inquiry |
PGF-27H | Recombinant Human PGF, StrepII-tagged | +Inquiry |
Pgf-54M | Recombinant Mouse Pgf protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket