Recombinant Human PGF Protein, His-tagged

• Cat.No.: PGF-04H
• Product Overview: Recombinant human PIGF (21-170aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.

Specification

• Description: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 18.3kDa (160aa)
• Protein length: 21-170aa
• AA Sequence: AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: PGF placental growth factor [ Homo sapiens (human) ]
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL; PIGF; PLGF; PlGF-2; D12S1900; SHGC-10760; placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein
• Gene ID: 5228
• mRNA Refseq: NM_002632
• Protein Refseq: NP_002623
• MIM: 601121
• UniProt ID: P49763