Recombinant Human PFKFB3, GST-tagged
Cat.No. : | PFKFB3-82912TH |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProductOverview : | Recombinant human PFKFB3 partial ORF ( 412 a.a. - 520 a.a.) fused with a GST-tag at N-terminal was expressed in wheat germ and purified by Glutathione Sepharose. |
Description : | PFKM is regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Three phosphofructokinase isozymes exist in humans: muscle, liver and platelet. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease. |
MolecularMass : | 37.73 kDa |
AA-Sequence : | CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH |
StorageBuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Officialsymbol : | PFKFB3 |
Gene Name | PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ] |
Synonyms | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; Renal carcinoma antigen NY-REN-56; FLJ37326; 6PF-2-K/Fru-2,6-P2ase 3; OTTHUMP00000019041; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; OTTHUMP00000019044; iPFK-2; OTTHUMP00000019048; PFK/FBPase 3; PFK2; IPFK2; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; OTTHUMP00000019052; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; OTTHUMP00000019039; OTTHUMP00000019040; OTTHUMP00000019045; OTTHUMP00000019046; OTTHUMP00000019047; OTTHUMP00000019050 |
Gene ID | 5209 |
mRNA Refseq | NM_001145443 |
Protein Refseq | NP_001138915 |
MIM | 605319 |
UniProt ID | Q5VX15 |
Chromosome Location | 10p15.1 |
Pathway | AMPK signaling, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem |
Function | 6-phosphofructo-2-kinase activity; 6-phosphofructo-2-kinase activity; ATP binding; catalytic activity; fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity; identical protein binding; kinase activity; nucleotide binding; protein binding; transferase activity |
◆ Recombinant Proteins | ||
PFKFB3-12572Z | Recombinant Zebrafish PFKFB3 | +Inquiry |
PFKFB3-518H | Active Recombinant Human PFKFB3 Protein, His & GST-tagged | +Inquiry |
PFKFB3-82912TH | Recombinant Human PFKFB3, GST-tagged | +Inquiry |
PFKFB3-24H | Active Recombinant Human PFKFB3 protein, His-tagged | +Inquiry |
PFKFB3-4052R | Recombinant Rat PFKFB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFKFB3 Products
Required fields are marked with *
My Review for All PFKFB3 Products
Required fields are marked with *
0
Inquiry Basket