Recombinant Human PFKFB3, GST-tagged

Cat.No. : PFKFB3-82912TH
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
ProductOverview : Recombinant human PFKFB3 partial ORF ( 412 a.a. - 520 a.a.) fused with a GST-tag at N-terminal was expressed in wheat germ and purified by Glutathione Sepharose.
Description : PFKM is regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Three phosphofructokinase isozymes exist in humans: muscle, liver and platelet. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease.
MolecularMass : 37.73 kDa
AA-Sequence : CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
StorageBuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Officialsymbol : PFKFB3
Gene Name PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ]
Synonyms 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; Renal carcinoma antigen NY-REN-56; FLJ37326; 6PF-2-K/Fru-2,6-P2ase 3; OTTHUMP00000019041; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; OTTHUMP00000019044; iPFK-2; OTTHUMP00000019048; PFK/FBPase 3; PFK2; IPFK2; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; OTTHUMP00000019052; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; OTTHUMP00000019039; OTTHUMP00000019040; OTTHUMP00000019045; OTTHUMP00000019046; OTTHUMP00000019047; OTTHUMP00000019050
Gene ID 5209
mRNA Refseq NM_001145443
Protein Refseq NP_001138915
MIM 605319
UniProt ID Q5VX15
Chromosome Location 10p15.1
Pathway AMPK signaling, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem
Function 6-phosphofructo-2-kinase activity; 6-phosphofructo-2-kinase activity; ATP binding; catalytic activity; fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity; identical protein binding; kinase activity; nucleotide binding; protein binding; transferase activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PFKFB3 Products

Required fields are marked with *

My Review for All PFKFB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon