Recombinant Human PEX26 protein, GST-tagged

• Cat.No.: PEX26-301326H
• Product Overview: Recombinant Human PEX26 (1-246 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-His246
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSH
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PEX26 peroxisomal biogenesis factor 26 [ Homo sapiens ]
• Official Symbol: PEX26
• Synonyms: PEX26; peroxisomal biogenesis factor 26; peroxisome biogenesis factor 26; peroxisome assembly protein 26; FLJ20695; peroxin-26; peroxisome biogenesis disorder, complementation group 8; peroxisome biogenesis disorder, complementation group A; PEX26M1T; Pex26pM1T
• Gene ID: 55670
• mRNA Refseq: NM_001127649
• Protein Refseq: NP_001121121
• UniProt ID: Q7Z412