Recombinant Human PERP Full Length Transmembrane protein, His-SUMO & Myc-tagged
Cat.No. : | PERP-2451H |
Product Overview : | Recombinant Human PERP protein(Q96FX8)(1-193aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-193aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.4kDa |
AA Sequence : | MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PERP PERP, TP53 apoptosis effector [ Homo sapiens ] |
Official Symbol | PERP |
Synonyms | PERP; PERP, TP53 apoptosis effector; p53 apoptosis effector related to PMP-22; dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW; KCP-1; 1110017A08Rik; transmembrane protein THW; p53-induced protein PIGPC1; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53 apoptosis effector related to PMP22; RP3-496H19.1; |
Gene ID | 64065 |
mRNA Refseq | NM_022121 |
Protein Refseq | NP_071404 |
MIM | 609301 |
UniProt ID | Q96FX8 |
◆ Recombinant Proteins | ||
PERP-12638M | Recombinant Mouse PERP Protein | +Inquiry |
PERP-2451H | Recombinant Human PERP Full Length Transmembrane protein, His-SUMO & Myc-tagged | +Inquiry |
PERP-4053H | Recombinant Human PERP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL4526HF | Recombinant Full Length Human P53 Apoptosis Effector Related To Pmp-22(Perp) Protein, His&Myc-Tagged | +Inquiry |
PERP-5076C | Recombinant Chicken PERP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PERP-478HCL | Recombinant Human PERP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PERP Products
Required fields are marked with *
My Review for All PERP Products
Required fields are marked with *
0
Inquiry Basket