Recombinant Human PERP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PERP-4053H
• Product Overview: PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: PERP (P53 Apoptosis Effector Related To PMP22) is a Protein Coding gene. Diseases associated with PERP include Palmoplantar Keratoderma, Mutilating, With Periorificial Keratotic Plaques and Ankyloblepharon-Ectodermal Defects-Cleft Lip/Palate. Among its related pathways are Keratinization and TP53 Regulates Transcription of Cell Death Genes. An important paralog of this gene is TMEM47.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.4 kDa
• AA Sequence: MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PERP p53 apoptosis effector related to PMP22 [ Homo sapiens (human) ]
• Official Symbol: PERP
• Synonyms: PERP; PERP, TP53 apoptosis effector; p53 apoptosis effector related to PMP-22; dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW; KCP-1; 1110017A08Rik; transmembrane protein THW; p53-induced protein PIGPC1; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53 apoptosis effector related to PMP22; RP3-496H19.1
• Gene ID: 64065
• mRNA Refseq: NM_022121
• Protein Refseq: NP_071404
• MIM: 609301
• UniProt ID: Q96FX8