Recombinant Human PEBP1

Cat.No. : PEBP1-30791TH
Product Overview : Recombinant Full Length Human PBP produced in Saccharomyces cerevisiae; 187 amino acids, MWt 21 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRK KYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Sequence Similarities : Belongs to the phosphatidylethanolamine-binding protein family.
Full Length : Full L.
Gene Name PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ]
Official Symbol PEBP1
Synonyms PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP;
Gene ID 5037
mRNA Refseq NM_002567
Protein Refseq NP_002558
MIM 604591
Uniprot ID P30086
Chromosome Location 12q24
Pathway Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PEBP1 Products

Required fields are marked with *

My Review for All PEBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon