Recombinant Human PDZRN3 protein, His-tagged

• Cat.No.: PDZRN3-4543H
• Product Overview: Recombinant Human PDZRN3 protein(770-871 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 770-871 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: TLEISPDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSPYKHA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: PDZRN3 PDZ domain containing ring finger 3 [ Homo sapiens ]
• Official Symbol: PDZRN3
• Synonyms: PDZRN3; PDZ domain containing ring finger 3; E3 ubiquitin-protein ligase PDZRN3; KIAA1095; likely ortholog of mouse semaF cytoplasmic domain associated protein 3; LNX3; SEMACAP3; ligand of Numb protein X 3; PDZ domain-containing RING finger protein 3; semaphorin cytoplasmic domain-associated protein 3
• Gene ID: 23024
• mRNA Refseq: NM_015009
• Protein Refseq: NP_055824
• MIM: 609729
• UniProt ID: Q9UPQ7