Recombinant Human MYL9 protein, His-tagged

• Cat.No.: MYL9-3744H
• Product Overview: Recombinant Human MYL9 protein(1-118 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-118 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Gene Information

• Gene Name: MYL9 myosin, light chain 9, regulatory [ Homo sapiens ]
• Official Symbol: MYL9
• Synonyms: MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505
• Gene ID: 10398
• mRNA Refseq: NM_006097
• Protein Refseq: NP_006088
• MIM: 609905
• UniProt ID: P24844