Recombinant Human PDZD11 protein, His-SUMO-tagged

• Cat.No.: PDZD11-4503H
• Product Overview: Recombinant Human PDZD11 protein(Q5EBL8)(1-140aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-140aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.1 kDa
• AA Sequence: MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PDZD11 PDZ domain containing 11 [ Homo sapiens ]
• Official Symbol: PDZD11
• Synonyms: PDZD11; PDZ domain containing 11; PDZK11; PDZ domain-containing protein 11; ATPase-interacting PDZ protein; PISP; AIPP1
• Gene ID: 51248
• mRNA Refseq: NM_016484
• Protein Refseq: NP_057568
• MIM: 300632
• UniProt ID: Q5EBL8