Recombinant Human PDXK protein, GST-tagged

• Cat.No.: PDXK-3330H
• Product Overview: Recombinant Human PDXK protein(O00764)(1-312aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-312aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 62.1 kDa
• AA Sequence: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PDXK pyridoxal (pyridoxine, vitamin B6) kinase [ Homo sapiens ]
• Official Symbol: PDXK
• Synonyms: PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97 , chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; pyridoxine kinase; vitamin B6 kinase; pyridoxamine kinase; C21orf97; C21orf124; FLJ37311; MGC31754; MGC52346; DKFZp566A071
• Gene ID: 8566
• mRNA Refseq: NM_003681
• Protein Refseq: NP_003672
• MIM: 179020
• UniProt ID: O00764