Recombinant Human PDXK Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDXK-4506H
• Product Overview: PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Molecular Mass: 35.1 kDa
• AA Sequence: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDXK pyridoxal kinase [ Homo sapiens (human) ]
• Official Symbol: PDXK
• Synonyms: PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97, chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79; pyridoxine kinase; vitamin B6 kinase; pyridoxamine kinase; C21orf97; C21orf124; FLJ37311; MGC31754; MGC52346; DKFZp566A071
• Gene ID: 8566
• mRNA Refseq: NM_003681
• Protein Refseq: NP_003672
• MIM: 179020
• UniProt ID: O00764