Recombinant Human PDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PDRG1-4099H
Product Overview : PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May play a role in chaperone-mediated protein folding.
Molecular Mass : 15.5 kDa
AA Sequence : MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PDRG1 p53 and DNA-damage regulated 1 [ Homo sapiens (human) ]
Official Symbol PDRG1
Synonyms PDRG1; p53 and DNA-damage regulated 1; C20orf126, chromosome 20 open reading frame 126; p53 and DNA damage-regulated protein 1; dJ310O13.3; p53 and DNA damage regulated 1; PDRG; C20orf126;
Gene ID 81572
mRNA Refseq NM_030815
Protein Refseq NP_110442
MIM 610789
UniProt ID Q9NUG6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDRG1 Products

Required fields are marked with *

My Review for All PDRG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon