Recombinant Human PDGFA Protein, GMP Grade, Animal-Free

• Cat.No.: PDGFA-39HG
• Product Overview: GMP Recombinant Human PDGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells.
• AA Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens (human) ]
• Official Symbol: PDGFA
• Synonyms: PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A
• Gene ID: 5154
• mRNA Refseq: NM_002607
• Protein Refseq: NP_002598
• MIM: 173430
• UniProt ID: P04085