Recombinant Human platelet-derived growth factor alpha polypeptide Protein, HA tagged

• Cat.No.: PDGFA-54H
• Product Overview: Recombinant Human PDGFA Protein (87-211aa) with N-HA tag was expressed in Yeast (animal free media and environment).

Specification

• Species: Human
• Source: Yeast
• Tag: HA
• Protein Length: 87-196 a.a.
• Description: This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants.
• Tag: N-HA
• Form: Lyophilized
• Molecular Mass: 15.4 kDa
• AA Sequence: YPYDVPDYASIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
• Endotoxin: < 0.2 EU/μg of protein as determined by the LAL method.
• Purity: 0.95
• Storage: Stable for at least one year at -20 centigrade. Upon reconstitution PDGFA can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months.
• Concentration: 120 μg/μL
• Storage Buffer: 20 mM potassium phosphate, pH 7.0
• Reconstitution: Spin the vial briefly, add distilled sterile water.

Gene Information

• Gene Name: PDGFA platelet-derived growth factor alpha polypeptide [Homo sapiens (human)]
• Official Symbol: PDGFA
• Synonyms: PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A
• Gene ID: 5154
• mRNA Refseq: NM_002607
• Protein Refseq: NP_002598
• MIM: 173430
• UniProt ID: P04085