Recombinant Human PDE3A

• Cat.No.: PDE3A-29931TH
• Product Overview: Recombinant fragment of Human PDE3A with N-terminal proprietary tag.Mol Wt 37.51 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 108 amino acids
• Description: This gene encodes a member of the cGMP-inhibited cyclic nucleotide phosphodiesterase (cGI-PDE) family. cGI-PDE enzymes hydrolyze both cAMP and cGMP, and play critical roles in many cellular processes by regulating the amplitude and duration of intracellular cyclic nucleotide signals. The encoded protein mediates platelet aggregation and also plays important roles in cardiovascular function by regulating vascular smooth muscle contraction and relaxation. Inhibitors of the encoded protein may be effective in treating congestive heart failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Weight: 37.510kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAP DLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTP SRTDDTAQVTSDYETNNNSDSSDIVQNE
• Sequence Similarities: Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.

Gene Information

• Gene Name: PDE3A phosphodiesterase 3A, cGMP-inhibited [ Homo sapiens ]
• Official Symbol: PDE3A
• Synonyms: PDE3A; phosphodiesterase 3A, cGMP-inhibited; cGMP-inhibited 3,5-cyclic phosphodiesterase A; CGI PDE
• Gene ID: 5139
• mRNA Refseq: NM_000921
• Protein Refseq: NP_000912
• MIM: 123805
• Uniprot ID: Q14432
• Chromosome Location: 12p12.2
• Pathway: G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem
• Function: 3,5-cyclic-AMP phosphodiesterase activity; cAMP binding; cGMP-inhibited cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding