Recombinant Human PDE2A
Cat.No. : | PDE2A-29979TH |
Product Overview : | Recombinant fragment of Human PDE2A (amino acids 850-940) with a N terminal proprietary tag; Predicted MWt 35.64 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 91 amino acids |
Description : | cGMP-dependent 3,5-cyclic phosphodiesterase is an enzyme that in humans is encoded by the PDE2A gene. |
Molecular Weight : | 35.640kDa inclusive of tags |
Tissue specificity : | Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA |
Sequence Similarities : | Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.Contains 2 GAF domains. |
Gene Name | PDE2A phosphodiesterase 2A, cGMP-stimulated [ Homo sapiens ] |
Official Symbol | PDE2A |
Synonyms | PDE2A; phosphodiesterase 2A, cGMP-stimulated; cGMP-dependent 3,5-cyclic phosphodiesterase; |
Gene ID | 5138 |
mRNA Refseq | NM_001143839 |
Protein Refseq | NP_001137311 |
MIM | 602658 |
Uniprot ID | O00408 |
Chromosome Location | 11q13.1-q14.1 |
Pathway | G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Nitric oxide stimulates guanylate cyclase, organism-specific biosystem; Platelet homeostasis, organism-specific biosystem; |
Function | 3,5-cyclic-nucleotide phosphodiesterase activity; TPR domain binding; cAMP binding; cGMP binding; cGMP binding; |
◆ Recombinant Proteins | ||
PDE2A-3815H | Recombinant Human PDE2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE2A-906H | Recombinant Human PDE2A , His tagged | +Inquiry |
PDE2A-29979TH | Recombinant Human PDE2A | +Inquiry |
PDE2A-606H | Recombinant Human PDE2A | +Inquiry |
PDE4B-146H | Recombinant Human PDE2A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE2A-591HCL | Recombinant Human PDE2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE2A Products
Required fields are marked with *
My Review for All PDE2A Products
Required fields are marked with *
0
Inquiry Basket