Recombinant Human PDE2A

• Cat.No.: PDE2A-29979TH
• Product Overview: Recombinant fragment of Human PDE2A (amino acids 850-940) with a N terminal proprietary tag; Predicted MWt 35.64 kDa including the tag.

Specification

• Description: cGMP-dependent 3,5-cyclic phosphodiesterase is an enzyme that in humans is encoded by the PDE2A gene.
• Protein length: 91 amino acids
• Molecular Weight: 35.640kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
• Sequence Similarities: Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.Contains 2 GAF domains.
• Tag: Non

Gene Information

• Gene Name: PDE2A phosphodiesterase 2A, cGMP-stimulated [ Homo sapiens ]
• Official Symbol: PDE2A
• Synonyms: PDE2A; phosphodiesterase 2A, cGMP-stimulated; cGMP-dependent 3,5-cyclic phosphodiesterase
• Gene ID: 5138
• mRNA Refseq: NM_001143839
• Protein Refseq: NP_001137311
• MIM: 602658
• Uniprot ID: O00408
• Chromosome Location: 11q13.1-q14.1
• Pathway: G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Nitric oxide stimulates guanylate cyclase, organism-specific biosystem; Platelet homeostasis, organism-specific biosystem
• Function: 3,5-cyclic-nucleotide phosphodiesterase activity; TPR domain binding; cAMP binding; cGMP binding; cGMP binding