Recombinant Human PDCD5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDCD5-2528H
• Product Overview: PDCD5 MS Standard C13 and N15-labeled recombinant protein (NP_004699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12
• Molecular Mass: 14.3 kDa
• AA Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDCD5 programmed cell death 5 [ Homo sapiens (human) ]
• Official Symbol: PDCD5
• Synonyms: PDCD5; programmed cell death 5; programmed cell death protein 5; MGC9294; TF1 cell apoptosis related gene 19; TFAR19; TFAR19 novel apoptosis related; TFAR19 novel apoptosis-related; TF1 cell apoptosis-related gene 19; TF-1 cell apoptosis-related protein 19; FLJ42784
• Gene ID: 9141
• mRNA Refseq: NM_004708
• Protein Refseq: NP_004699
• MIM: 604583
• UniProt ID: O14737