Recombinant Human PDCD5 Protein

• Cat.No.: PDCD5-001H
• Product Overview: Recombinant Human PDCD5 (1-125aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 1-125 a.a.
• Description: PDCD5, also known as programmed cell death5, which encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. The conformation of PDCD5 protein is a stable helical core consisting of a triple-helix bundle and two dissociated terminal regions. This is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.
• Form: Liquid
• Molecular Mass: 14.2 kDa
• Purity: > 90% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4)
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Gene Information

• Gene Name: PDCD5 programmed cell death 5 [ Homo sapiens (human) ]
• Official Symbol: PDCD5
• Synonyms: PDCD5; programmed cell death 5; TFAR19; programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; TF1 cell apoptosis-related gene 19; TFAR19 novel apoptosis-related
• Gene ID: 9141
• mRNA Refseq: NM_004708
• Protein Refseq: NP_004699
• MIM: 604583
• UniProt ID: O14737