Recombinant Human PDCD1 Protein (G22-V170), C-6×His tagged

• Cat.No.: PDCD1-75H
• Product Overview: Recombinant human PD-1, extracellular domain is produced in E. coli. The final protein sequence contains G22-V170 of human PD1 fused to a polyhistidine tag on the carboxyl terminus. This product is sterile and does not contain any components of animal origin.

Specification

• Description: Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity.
• Source: E. coli
• Species: Human
• Tag: His
• Protein length: G22-V170
• AA Sequence: MPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
• Purity: > 95% by SDS-PAGE
• Applications: Research in immunotherapy
• Quality Control Test: Verified by disulfide mapping and Mass Spectrometry analysis.
• Notes: For research use only
• Storage: Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade.
• Concentration: 0.4 mg/mL
• Storage Buffer: Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM MES buffer at pH 6.5

Gene Information

• Gene Name: PDCD1 programmed cell death 1 [ Homo sapiens (human) ]
• Official Symbol: PDCD1
• Synonyms: PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; protein PD-1; PD-1; SLEB2; hPD-1; hPD-l
• Gene ID: 5133
• mRNA Refseq: NM_005018
• Protein Refseq: NP_005009
• MIM: 600244
• UniProt ID: Q15116