Recombinant Human PCOLCE
Cat.No. : | PCOLCE-30795TH |
Product Overview : | Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 449 amino acids |
Description : | Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. |
Molecular Weight : | 75.000kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF |
Sequence Similarities : | Contains 2 CUB domains.Contains 1 NTR domain. |
Gene Name | PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ] |
Official Symbol | PCOLCE |
Synonyms | PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer; |
Gene ID | 5118 |
mRNA Refseq | NM_002593 |
Protein Refseq | NP_002584 |
MIM | 600270 |
Uniprot ID | Q15113 |
Chromosome Location | 7q22 |
Function | collagen binding; heparin binding; peptidase activator activity; |
◆ Recombinant Proteins | ||
PCOLCE-6411H | Recombinant Human PCOLCE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCOLCE-6802H | Recombinant Human PCOLCE protein, His & S-tagged | +Inquiry |
PCOLCE-372H | Recombinant Human PCOLCE | +Inquiry |
PCOLCE-838H | Recombinant Human PCOLCE, T7-tagged | +Inquiry |
PCOLCE-4819H | Recombinant Human PCOLCE Protein (Ala315-Cys437), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCOLCE-3375HCL | Recombinant Human PCOLCE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCOLCE Products
Required fields are marked with *
My Review for All PCOLCE Products
Required fields are marked with *
0
Inquiry Basket