Recombinant Human PCMT1

Cat.No. : PCMT1-30554TH
Product Overview : Recombinant full length Human PCMT1 expressed in Saccharomyces cerevisiae; 227 amino acids, MWt 24.6 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation back to the normal L-aspartyl form. The encoded protein may play a protective role in the pathogenesis of Alzheimers disease, and single nucleotide polymorphisms in this gene have been associated with spina bifida and premature ovarian failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHY AKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHE GAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELV DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAI HVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQ YDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK
Full Length : Full L.
Gene Name PCMT1 protein-L-isoaspartate (D-aspartate) O-methyltransferase [ Homo sapiens ]
Official Symbol PCMT1
Synonyms PCMT1; protein-L-isoaspartate (D-aspartate) O-methyltransferase; protein-L-isoaspartate(D-aspartate) O-methyltransferase;
Gene ID 5110
mRNA Refseq NM_001252049
Protein Refseq NP_001238978
MIM 176851
Uniprot ID P22061
Chromosome Location 6q22.3-q24
Function protein-L-isoaspartate (D-aspartate) O-methyltransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PCMT1 Products

Required fields are marked with *

My Review for All PCMT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon