Recombinant Human PCDH19 protein, GST-tagged

• Cat.No.: PCDH19-15H
• Product Overview: Recombinant Human PCDH19(241 a.a. - 340 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 241-340 a.a.
• Description: The protein encoded by this gene is a member of the delta-2 protocadherin subclass of the cadherin superfamily. The encoded protein is thought to be a calcium-dependent cell-adhesion protein that is primarily expressed in the brain. Defects in this gene are a cause of epilepsy female-restricted with mental retardation (EFMR). Three transcript variants encoding different isoforms have been found for this gene
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQP DLIINGAPLPETENYSFDSNYVNSR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PCDH19 protocadherin 19 [ Homo sapiens ]
• Official Symbol: PCDH19
• Synonyms: PCDH19; protocadherin 19; EFMR, epilepsy, female restricted, with mental retardation (Juberg Hellman syndrome); protocadherin-19; EIEE9; KIAA1313; EFMR; DKFZp686P1843
• Gene ID: 57526
• mRNA Refseq: NM_001105243
• Protein Refseq: NP_001098713
• MIM: 300460
• UniProt ID: Q8TAB3
• Chromosome Location: Xq22.1
• Function: calcium ion binding