Recombinant Human PBK Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PBK-1788H |
Product Overview : | PBK MS Standard C13 and N15-labeled recombinant protein (NP_060962) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PBK PDZ binding kinase [ Homo sapiens (human) ] |
Official Symbol | PBK |
Synonyms | PBK; PDZ binding kinase; lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; CT84; FLJ14385; Nori 3; SPK; T LAK cell originated protein kinase; TOPK; PDZ-binding kinase; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase; Nori-3; |
Gene ID | 55872 |
mRNA Refseq | NM_018492 |
Protein Refseq | NP_060962 |
MIM | 611210 |
UniProt ID | Q96KB5 |
◆ Recombinant Proteins | ||
PBK-447H | Recombinant Human PDZ Binding Kinase, GST-tagged, Active | +Inquiry |
Pbk-4691M | Recombinant Mouse Pbk Protein, Myc/DDK-tagged | +Inquiry |
PBK-4643H | Recombinant Human PBK protein, GST-tagged | +Inquiry |
PBK-619H | Recombinant Human PBK protein, His-tagged | +Inquiry |
PBK-1612H | Recombinant Human PBK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBK-713HCL | Recombinant Human PBK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PBK Products
Required fields are marked with *
My Review for All PBK Products
Required fields are marked with *
0
Inquiry Basket