Recombinant Human PAX7

Description :	This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
Protein length :	111 amino acids
Molecular Weight :	38.210kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT GYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCL FMESYKVVSGWGMSISQMEKLKSSQMEQFT
Sequence Similarities :	Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain.
Tag :	Non

Gene Name	PAX7 paired box 7 [ Homo sapiens ]
Official Symbol	PAX7
Synonyms	PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1;
Gene ID	5081
mRNA Refseq	NM_001135254
Protein Refseq	NP_001128726
MIM	167410
Uniprot ID	P23759
Chromosome Location	1p36.13
Pathway	Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function	sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;