Recombinant Human PAX7 protein, T7/His-tagged
Cat.No. : | PAX7-132H |
Product Overview : | Recombinant human Pax7 cDNA (520aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFIN GRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYK RENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGN RLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARW RKQAGANQLAAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAAD TSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISAS CSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKV VSGWGMSISQMEKLKSSQMEQFT |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Publications : |
DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD (2020)
|
Gene Name | PAX7 paired box 7 [ Homo sapiens ] |
Official Symbol | PAX7 |
Synonyms | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; paired domain gene 7; paired box homeotic gene 7; PAX7 transcriptional factor; HUP1; RMS2; PAX7B; FLJ37460; |
Gene ID | 5081 |
mRNA Refseq | NM_001135254 |
Protein Refseq | NP_001128726 |
MIM | 167410 |
UniProt ID | P23759 |
Chromosome Location | 1p36.13 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
PAX7-6754H | Recombinant Human PAX7 protein, GST-tagged | +Inquiry |
PAX7-2924H | Recombinant Human PAX7 protein, His-tagged | +Inquiry |
PAX7-29057TH | Recombinant Human PAX7 | +Inquiry |
PAX7-4801H | Recombinant Human PAX7 Protein (Arg355-Gln467), N-His tagged | +Inquiry |
PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAX7 Products
Required fields are marked with *
My Review for All PAX7 Products
Required fields are marked with *
0
Inquiry Basket