Recombinant Human PALLD protein, His-tagged

• Cat.No.: PALLD-711H
• Product Overview: Recombinant Human PALLD protein(Q8WX93)(Phe881-Tyr990), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Phe881-Tyr990
• Form: 0.15 M Phosphate buffered saline, pH 7.4
• Molecular Mass: 15 kDa
• AASequence: FPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQY
• Storage: -20°C or lower, for long term storage.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PALLD palladin, cytoskeletal associated protein [ Homo sapiens ]
• Official Symbol: PALLD
• Synonyms: PALLD; palladin, cytoskeletal associated protein; palladin; CGI 151; KIAA0992; SIH002; myoneurin; sarcoma antigen NY-SAR-77; MYN; PNCA1; CGI151; CGI-151; FLJ22190; FLJ38193; FLJ39139; FLJ61376
• Gene ID: 23022
• mRNA Refseq: NM_001166108
• Protein Refseq: NP_001159580
• MIM: 608092
• UniProt ID: Q8WX93