Recombinant Human PAICS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PAICS-754H |
Product Overview : | PAICS MS Standard C13 and N15-labeled recombinant protein (NP_006443) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PAICS phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [ Homo sapiens (human) ] |
Official Symbol | PAICS |
Synonyms | PAICS; phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase; PAIS; multifunctional protein ADE2; ADE2H1; AIRC; AIR carboxylase; SAICAR synthetase; multifunctional protein ADE2H1; ADE2; MGC1343; MGC5024; DKFZp781N1372; |
Gene ID | 10606 |
mRNA Refseq | NM_006452 |
Protein Refseq | NP_006443 |
MIM | 172439 |
UniProt ID | P22234 |
◆ Recombinant Proteins | ||
PAICS-6470M | Recombinant Mouse PAICS Protein, His (Fc)-Avi-tagged | +Inquiry |
PAICS-4257R | Recombinant Rat PAICS Protein | +Inquiry |
PAICS-7072C | Recombinant Chicken PAICS | +Inquiry |
PAICS-1378HFL | Recombinant Full Length Human PAICS Protein, C-Flag-tagged | +Inquiry |
PAICS-12313M | Recombinant Mouse PAICS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAICS-3461HCL | Recombinant Human PAICS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAICS Products
Required fields are marked with *
My Review for All PAICS Products
Required fields are marked with *
0
Inquiry Basket