Recombinant Human PABPC4 protein, His-tagged

• Cat.No.: PABPC4-1504H
• Product Overview: Recombinant Human PABPC4 protein(285-631 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 285-631 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PABPC4 poly(A) binding protein, cytoplasmic 4 (inducible form) [ Homo sapiens ]
• Official Symbol: PABPC4
• Synonyms: PABPC4; poly(A) binding protein, cytoplasmic 4 (inducible form); polyadenylate-binding protein 4; APP 1; iPABP; PABP-4; poly(A)-binding protein 4; activated-platelet protein 1; inducible poly(A)-binding protein; APP1; APP-1; PABP4; FLJ43938
• Gene ID: 8761
• mRNA Refseq: NM_001135653
• Protein Refseq: NP_001129125
• MIM: 603407
• UniProt ID: Q13310