Recombinant Human PABPC1 protein, GST-tagged

• Cat.No.: PABPC1-648H
• Product Overview: Recombinant Human PABPC1(1 a.a. - 636 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-636 a.a.
• Description: This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 97.1 kDa
• AA Sequence: MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFD VIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEA AERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTD ESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ AHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM PGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLN AQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PABPC1 poly(A) binding protein, cytoplasmic 1 [ Homo sapiens ]
• Official Symbol: PABPC1
• Synonyms: PABPC1; poly(A) binding protein, cytoplasmic 1; PAB1, PABPC2, poly(A) binding protein, cytoplasmic 2; polyadenylate-binding protein 1; PABP1; PABPL1; poly(A) binding protein, cytoplasmic 2; PAB1; PABP; PABPC2
• Gene ID: 26986
• mRNA Refseq: NM_002568
• Protein Refseq: NP_002559
• MIM: 604679
• UniProt ID: P11940
• Chromosome Location: 8q22.2-q23
• Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by AUF1 (hnRNP D0), organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem
• Function: RNA binding; nucleotide binding; poly(A) RNA binding; poly(A) RNA binding; protein C-terminus binding; protein binding; translation activator activity